2KFV: FK506-binding protein 3

Structure of the amino-terminal domain of human FK506-binding protein 3 / Northeast Structural Genomics Consortium Target HT99A. Determined by solution NMR. Released 23 Jun 2009.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 594
Mol. weight: 10.45 kDa
Released: 23 Jun 2009

Explore 2KFV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KFV contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	31-35	5
α-helix	42-51	10
β-strand	52	1	1
α-helix	54-59	6
α-helix	66-70	5
α-helix	75-88	14
β-strand	91	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FK506-binding protein 3	A	protein	92	Homo sapiens	Q00688 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KFV_1 FK506-binding protein 3 (chains A)
MGSSHHHHHHSSGLVPRGSMAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEH
KLLGNIKNVAKTANKDHLVTAYNHLFETKRFK

Primary citation

Structure of the N-terminal domain of FK506-binding protein 3. Sunnerhagen, M. To be published.

Other PDB entries of the same protein (UniProt Q00688 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GPG 1.67 Å, Co-crystal structure of the FK506 binding domain of human FKBP25, Rapamycin and the FRB…
5D75 1.83 Å, Crystal structure of Human FKBD25 in complex with FK506
1PBK 2.5 Å, Homologous domain of human FKBP25
2MPH Solution Structure of human FK506 binding Protein 25

Browse structure collections

About this viewer

MolViewer shows 2KFV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.