5D75: Human FKBD25

Crystal structure of Human FKBD25 in complex with FK506. Determined by X-ray diffraction at 1.83 Å resolution. Released 6 Apr 2016.

Method: X-ray diffraction
Resolution: 1.83 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,146
Mol. weight: 16.03 kDa
Ligands: JEF, FK5
Released: 6 Apr 2016

Explore 5D75 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5D75 contains 4 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	111-117	7	1
β-strand	130-139	10	1
β-strand	144-147	4	1
β-strand	162-165	4	1
α-helix	173-179	7
α-helix	182-183	2
β-strand	187-192	6	1
α-helix	194-196	3
β-strand	203	1	2
β-strand	208	1	2
α-helix	209	1
β-strand	214-224	11	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peptidyl-prolyl cis-trans isomerase FKBP3	A	protein	124	Homo sapiens	Q00688 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5D75_1 Peptidyl-prolyl cis-trans isomerase FKBP3 (chains A)
PKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGV
GKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDIDLEHH
HHHH

Ligands and cofactors

ID	Name	Formula	Copies
JEF	O-(O-(2-aminopropyl)-O'-(2-methoxyethyl)polypropylene glycol 500)	C30 H63 N O10	2
FK5	8-deethyl-8-[but-3-enyl]-ascomycin	C44 H69 N O12	1

Primary citation

Crystal structure of the FK506 binding domain of human FKBP25 in complex with FK506. Prakash, A., Rajan, S., Yoon, H.S. Protein Sci (2016) 25:905-910. DOI 10.1002/pro.2875 · PubMed

Other PDB entries of the same protein (UniProt Q00688 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GPG 1.67 Å, Co-crystal structure of the FK506 binding domain of human FKBP25, Rapamycin and the FRB…
1PBK 2.5 Å, Homologous domain of human FKBP25
2KFV Structure of the amino-terminal domain of human FK506-binding protein 3 / Northeast…
2MPH Solution Structure of human FK506 binding Protein 25

Browse structure collections

About this viewer

MolViewer shows 5D75 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.