2KG5: ARAP3-SAM

NMR Solution structure of ARAP3-SAM. Determined by solution NMR. Released 17 Nov 2009.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 619
Mol. weight: 10.86 kDa
Released: 17 Nov 2009

Explore 2KG5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KG5 contains 7 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	28	1	1
α-helix	29-33	5
α-helix	34-36	3
α-helix	39-41	3
α-helix	42-47	6
β-strand	52	1	1
α-helix	53-56	4
α-helix	61-67	7
α-helix	72-82	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Arf-GAP, Rho-GAP domain, ANK repeat and PH domain-containing protein 3	A	protein	100	Homo sapiens	Q8WWN8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KG5_1 Arf-GAP, Rho-GAP domain, ANK repeat and PH domain-containing protein 3 (chains A)
MGSSHHHHHHSSGLVPRGSHMAAPQDLDIAVWLATVHLEQYADTFRRHGLATAGAARGLG
HEELKQLGISATGHRKRILRLLQTGTEEGSLDPKSDSAME

Primary citation

The Sam domain of the lipid phosphatase Ship2 adopts a common model to interact with Arap3-Sam and EphA2-Sam. Leone, M., Cellitti, J., Pellecchia, M. BMC Struct Biol (2009) 9:59-59. DOI 10.1186/1472-6807-9-59 · PubMed

Other PDB entries of the same protein (UniProt Q8WWN8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7A9B 2.0 Å, Crystal structure of Shank1 PDZ domain with ARAP3-derived peptide
7YIR 2.1 Å, Crystal structure of N-terminal PH domain of ARAP3 protein from human
5JCP 2.1 Å, RhoGAP domain of ARAP3 in complex with RhoA in the transition state
5JD0 2.3 Å, crystal structure of ARAP3 RhoGAP domain
7YIS 3.3 Å, Crystal structure of N-terminal PH domain of ARAP3 protein in complex with inositol…
2LNW Identification and structural basis for a novel interaction between Vav2 and Arap3

Browse structure collections

About this viewer

MolViewer shows 2KG5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.