2KG7: Uncharacterized protein esxG

Structure and features of the complex formed by the tuberculosis virulence factors Rv0287 and Rv0288. Determined by solution NMR. Released 16 Mar 2010.

Method: Solution NMR
Organism: Mycobacterium tuberculosis
Chains: 2
Atoms: 1,417
Mol. weight: 20.27 kDa
Released: 16 Mar 2010

Explore 2KG7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KG7 contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	17-39	23
α-helix	40-42	3
α-helix	49-76	28

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	619-639	21
α-helix	641-643	3
α-helix	652-671	20
α-helix	673-675	3
α-helix	676-682	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Uncharacterized protein esxG (PE family protein)	A	protein	97	Mycobacterium tuberculosis	O53692 (AlphaFold model)
ESAT-6-like protein esxH	B	protein	97	Mycobacterium tuberculosis	P9WNK3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KG7_1 Uncharacterized protein esxG (PE family protein) (chains A)
MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVA
AAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF

Sequence of entity 2 (B), FASTA

>2KG7_2 ESAT-6-like protein esxH (chains B)
SMSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWN
QAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG

Primary citation

Solution structure of the M. tuberculosis EsxG-EsxH complex: functional implications and comparisons with other M. tuberculosis Esx family complexes. Ilghari, D., Lightbody, K.L., Veverka, V. et al. J Biol Chem (2011).

Browse structure collections

About this viewer

MolViewer shows 2KG7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.