A PH domain within OCRL bridges clathrin mediated membrane trafficking to phosphoinositide metabolis. Determined by solution NMR. Released 21 Jul 2009.
Explore 2KIE in 3D Show helices and sheets RCSB PDB PDBe
2KIE contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 15-26 | 12 | 1 |
| β-strand | 29-40 | 12 | 1 |
| β-strand | 43-50 | 8 | 1 |
| β-strand | 57-62 | 6 | 1 |
| β-strand | 68-71 | 4 | 1 |
| α-helix | 81-83 | 3 | |
| β-strand | 87-92 | 6 | 1 |
| β-strand | 99-103 | 5 | 1 |
| α-helix | 106-123 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Inositol polyphosphate 5-phosphatase OCRL-1 | A | protein | 124 | Homo sapiens | Q01968 (AlphaFold model) |
>2KIE_1 Inositol polyphosphate 5-phosphatase OCRL-1 (chains A) GPLGSMEPPLPVGAQPLATVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDI IPINSHFRCVQEAEETLLIDIASNSGCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQ KAQS
A PH domain within OCRL bridges clathrin-mediated membrane trafficking to phosphoinositide metabolism. Mao, Y., Balkin, D.M., Zoncu, R. et al. EMBO J (2009) 28:1831-1842. DOI 10.1038/emboj.2009.155 · PubMed
Other PDB entries of the same protein (UniProt Q01968 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2KIE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.