2KKR: Ataxin-7

Solution structure of SCA7 zinc finger domain from human ataxin-7 protein. Determined by solution NMR. Released 9 Jun 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 487
Mol. weight: 8.83 kDa
Ligands: ZN
Released: 9 Jun 2010

Explore 2KKR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KKR contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	369-374	6
α-helix	382-393	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ataxin-7	A	protein	74	Homo sapiens	O15265 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KKR_1 Ataxin-7 (chains A)
GSKFLNKRLSEREFDPDIHCGVIDLDTKKPCTRSLTCKTHSLTQRRAVQGRRKRFDVLLA
EHKNKTREKELIRH

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Histone deubiquitination by SAGA is modulated by an atypical zinc finger domain of Ataxin-7. Bonnet, J., Wang, Y., Atkinson, A. et al. To be published.

Other PDB entries of the same protein (UniProt O15265 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RDK 2.41 Å, Cryo-EM structure of the human SAGA co-activator complex
7KTR 2.93 Å, Cryo-EM structure of the human SAGA coactivator complex (TRRAP, core)
8H7G 3.7 Å, Cryo-EM structure of the human SAGA complex
7KTS 19.09 Å, Negative stain EM structure of the human SAGA coactivator complex (TRRAP, core, splicing…

Browse structure collections

About this viewer

MolViewer shows 2KKR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.