Solution structure of the b' domain of thermophilic fungal protein disulfide isomerase. Determined by solution NMR. Released 27 Oct 2009.
Explore 2KP2 in 3D Show helices and sheets RCSB PDB PDBe
2KP2 contains 7 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-10 | 3 | 1 |
| α-helix | 16-20 | 5 | |
| β-strand | 26-31 | 6 | 1 |
| α-helix | 37-49 | 13 | |
| β-strand | 56-61 | 6 | 1 |
| α-helix | 66-68 | 3 | |
| α-helix | 69-72 | 4 | |
| β-strand | 81-85 | 5 | 1 |
| β-strand | 92-94 | 3 | 1 |
| α-helix | 95-96 | 2 | |
| α-helix | 103-115 | 13 | |
| α-helix | 128-130 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein disulfide-isomerase | A | protein | 133 | Humicola insolens | P55059 (AlphaFold model) |
>2KP2_1 Protein disulfide-isomerase (chains A) GPLGSPLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTI DAKAFGAHAGNLNLKTDKFPAFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEP SIKSEPIPEKQEG
Redox-Dependent Domain Rearrangement of Protein Disulfide Isomerase Coupled with Exposure of Its Substrate-Binding Hydrophobic Surface. Serve, O., Kamiya, Y., Maeno, A. et al. J Mol Biol (2009). DOI 10.1016/j.jmb.2009.11.049 · PubMed
Other PDB entries of the same protein (UniProt P55059 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2KP2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.