Crystal structure of the b'-a' domain of oxidized protein disulfide isomerase complexed with alpha-synuclein peptide (31-41). Determined by X-ray diffraction at 1.6 Å resolution. Released 9 Sept 2015.
Explore 5CRW in 3D Show helices and sheets RCSB PDB PDBe
5CRW contains 10 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 210-212 | 3 | 1 |
| α-helix | 218-223 | 6 | |
| β-strand | 228-233 | 6 | 1 |
| α-helix | 236-252 | 17 | |
| β-strand | 258-263 | 6 | 1 |
| α-helix | 268-274 | 7 | |
| β-strand | 283-288 | 6 | 1 |
| β-strand | 293-296 | 4 | 1 |
| α-helix | 297-298 | 2 | |
| α-helix | 305-317 | 13 | |
| α-helix | 321-323 | 3 | |
| α-helix | 327-330 | 4 | |
| β-strand | 338-340 | 3 | 2 |
| α-helix | 342-349 | 8 | |
| β-strand | 355-361 | 7 | 2 |
| α-helix | 366-383 | 18 | |
| β-strand | 391-397 | 7 | 2 |
| β-strand | 412-416 | 5 | 2 |
| β-strand | 425-426 | 2 | 2 |
| α-helix | 433-443 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 32 | 1 | 3 |
| β-strand | 38 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein disulfide-isomerase | A | protein | 247 | Humicola insolens | P55059 (AlphaFold model) |
| Peptide from Alpha-synuclein | B | protein | 11 | Homo sapiens | P37840 (AlphaFold model) |
>5CRW_1 Protein disulfide-isomerase (chains A) GPLGSPLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTI DAKAFGAHAGNLNLKTDKFPAFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEP SIKSEPIPEKQEGPVTVVVAKNYNEIVLDDTKDVLIEFYAPWCGHCKALAPKYEELGALY AKSEFKDRVVIAKVDATANDVPDEIQGFPTIKLYPAGAKGQPVTYSGSRTVEDLIKFIAE NGKYKAA
>5CRW_2 Peptide from Alpha-synuclein (chains B) GKTKEGVLYVG
Structural basis of redox-dependent substrate binding of protein disulfide isomerase. Yagi-Utsumi, M., Satoh, T., Kato, K. Sci Rep (2015) 5:13909-13909. DOI 10.1038/srep13909 · PubMed
Other PDB entries of the same protein (UniProt P55059 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5CRW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.