2KR0: Proteasome ubiquitin receptor Rpn13

Solution structure of the proteasome ubiquitin receptor Rpn13. Determined by solution NMR. Released 26 May 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 2,952
Mol. weight: 42.49 kDa
Released: 26 May 2010

Explore 2KR0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KR0 contains 14 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	24-26	3	1
β-strand	28-30	3	2
β-strand	31-33	3	3
β-strand	38-40	3	3
β-strand	45-51	7	1
β-strand	57-63	7	1
β-strand	69-75	7	1
β-strand	80-84	5	2
β-strand	93-98	6	2
β-strand	104-109	6	2
α-helix	114-116	3
α-helix	117-129	13
α-helix	170-172	3
α-helix	264-274	11
α-helix	284-287	4
α-helix	288-290	3
α-helix	294-301	8
α-helix	304-310	7
α-helix	311-313	3
α-helix	324-327	4
α-helix	334-349	16
α-helix	354-359	6
α-helix	363-371	9
α-helix	374-383	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proteasomal ubiquitin receptor ADRM1	A	protein	411	Homo sapiens	Q16186 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KR0_1 Proteasomal ubiquitin receptor ADRM1 (chains A)
GPGSMTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSL
IHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQ
DEEHCRKVNEYLNNPPMPGALGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAG
LGGLGGLGALTGPGLASLLGSSGPPGSSSSSSSRSQSAAVTPSSTTSSTRATPAPSAPAA
ASATSPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNVPAGPAGGQQVDLASVLTPEI
MAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLM
CQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD

Primary citation

Structure of Proteasome Ubiquitin Receptor hRpn13 and Its Activation by the Scaffolding Protein hRpn2. Chen, X., Lee, B.H., Finley, D. et al. Mol Cell (2010) 38:404-415. DOI 10.1016/j.molcel.2010.04.019 · PubMed

Other PDB entries of the same protein (UniProt Q16186 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5V1Y 1.42 Å, Crystal structure of the ternary RPN13 PRU-RPN2 (940-953)-ubiquitin complex
6OI4 1.76 Å, RPN13 (19-132)-RPN2 (940-952) pY950-Ub complex
5IRS 1.8 Å, crystal structure of the proteasomal Rpn13 PRU-domain
8VWO 1.85 Å, Crystal structure of hRpn13 Pru bound with U-shaped peptide
4WLR 2.0 Å, Crystal Structure of mUCH37-hRPN13 CTD-hUb complex
5V1Z 2.0 Å, Crystal structure of the RPN13 PRU-RPN2 (932-953)-ubiquitin complex
8FTQ 2.1 Å, Crystal structure of hRpn13 Pru domain in complex with Ubiquitin and XL44
4UEL 2.3 Å, UCH-L5 in complex with ubiquitin-propargyl bound to the RPN13 DEUBAD domain
9E7K 2.41 Å, Crystal structure of the UCH37 RPN13 DEUBAD complex bound to an inhibitory nanobody in…
4UEM 2.82 Å, UCH-L5 in complex with the RPN13 DEUBAD domain
4WLQ 2.85 Å, Crystal structure of mUCH37-hRPN13 CTD complex
2KQZ Solution structure of the Rpn13 DEUBAD domain

Browse structure collections

About this viewer

MolViewer shows 2KR0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.