2KRE: E4B/UFD2A U-Box domain

Solution structure of E4B/UFD2A U-Box domain. Determined by solution NMR. Released 29 Dec 2009.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 808
Mol. weight: 11.55 kDa
Released: 29 Dec 2009

Explore 2KRE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KRE contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1233	1	1
β-strand	1240	1	1
β-strand	1244-1247	4	2
β-strand	1251-1254	4	2
α-helix	1255-1261	7
β-strand	1267	1	3
β-strand	1274	1	3
β-strand	1281-1282	2	2
α-helix	1284-1295	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin conjugation factor E4 B	A	protein	100	Homo sapiens	O95155 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KRE_1 Ubiquitin conjugation factor E4 B (chains A)
GSHKFAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHL
LNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH

Primary citation

Molecular Basis for the Association of Human E4B U Box Ubiquitin Ligase with E2-Conjugating Enzymes UbcH5c and Ubc4. Benirschke, R.C., Thompson, J.R., Nomine, Y. et al. Structure (2010) 18:955-965. DOI 10.1016/j.str.2010.04.017 · PubMed

Other PDB entries of the same protein (UniProt O95155 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5O75 1.48 Å, Ube4B U-box domain
3L1X 2.6 Å, Crystal Structure of U-box Domain of Human E4B Ubiquitin Ligase
3L1Z 3.17 Å, Crystal structure of the U-BOX domain of human E4B ubiquitin ligase in complex with…

Browse structure collections

About this viewer

MolViewer shows 2KRE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.