2KZB: Alpha-mannosidase binding domain of Atg19

Solution structure of alpha-mannosidase binding domain of Atg19. Determined by solution NMR. Released 21 Jul 2010.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 911
Mol. weight: 13.39 kDa
Released: 21 Jul 2010

Explore 2KZB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KZB contains 0 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	262-269	8	1
β-strand	272-279	8	1
β-strand	290-291	2	2
β-strand	305-306	2	2
β-strand	318-322	5	1
β-strand	335-338	4	2
β-strand	344-348	5	2
β-strand	356-357	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Autophagy-related protein 19	A	protein	118	Saccharomyces cerevisiae	P35193 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KZB_1 Autophagy-related protein 19 (chains A)
GPHMVEPPNERSLQITMNQRDNSLYFQLFNNTNSVLAGNCKLKFTDAGDKPTTQIIDMGP
HEIGIKEYKEYRYFPYALDLEAGSTIEIENQYGEVIFLGKYGSSPMINLRPPSRLSAE

Primary citation

Selective transport of alpha-mannosidase by autophagic pathways: structural basis for cargo recognition by Atg19 and Atg34. Watanabe, Y., Noda, N.N., Kumeta, H. et al. J Biol Chem (2010) 285:30026-30033. DOI 10.1074/jbc.M110.143545 · PubMed

Other PDB entries of the same protein (UniProt P35193 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5AZF 1.6 Å, Crystal structure of LGG-1 complexed with a WEEL peptide
5JGE 1.91 Å, Crystal structure of Atg19 coiled-coil complexed with Ape1 propeptide
2ZPN 2.7 Å, The crystal structure of Saccharomyces cerevisiae Atg8- Atg19(412-415) complex

Browse structure collections

About this viewer

MolViewer shows 2KZB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.