5JGE: Atg19 coiled-coil

Crystal structure of Atg19 coiled-coil complexed with Ape1 propeptide. Determined by X-ray diffraction at 1.91 Å resolution. Released 29 Jun 2016.

Method: X-ray diffraction
Resolution: 1.91 Å
Organism: Saccharomyces cerevisiae
Chains: 6
Atoms: 1,513
Mol. weight: 20.78 kDa
Released: 29 Jun 2016

Explore 5JGE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JGE contains 6 α-helices and 0 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	161-184	24

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	157-181	25

Chains C and F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	0-17	18

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	159-184	26

Chain E: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	157-184	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Autophagy-related protein 19	A, B, D, E	protein	32	Saccharomyces cerevisiae	P35193 (AlphaFold model)
Ape1 propeptide	C, F	protein	23	Saccharomyces cerevisiae	P14904 (AlphaFold model)

Sequence of entity 1 (A, B, D, E), FASTA

>5JGE_1 Autophagy-related protein 19 (chains A, B, D, E)
GPHMLDNFMKQLLKLEESLNKLELEQKVTNKE

Sequence of entity 2 (C, F), FASTA

>5JGE_2 Ape1 propeptide (chains C, F)
GPMEEQREILEQLKKTLQMLTVY

Primary citation

Structural Basis for Receptor-Mediated Selective Autophagy of Aminopeptidase I Aggregates. Yamasaki, A., Watanabe, Y., Adachi, W. et al. Cell Rep (2016) 16:19-27. DOI 10.1016/j.celrep.2016.05.066 · PubMed

Other PDB entries of the same protein (UniProt P35193 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5AZF 1.6 Å, Crystal structure of LGG-1 complexed with a WEEL peptide
2ZPN 2.7 Å, The crystal structure of Saccharomyces cerevisiae Atg8- Atg19(412-415) complex
2KZB Solution structure of alpha-mannosidase binding domain of Atg19

Browse structure collections

About this viewer

MolViewer shows 5JGE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.