2KZT: Tandem MA-3 Region of Pdcd4

Structure of the Tandem MA-3 Region of Pdcd4. Determined by solution NMR. Released 16 Mar 2011.

Method: Solution NMR
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 2,291
Mol. weight: 32.75 kDa
Released: 16 Mar 2011

Explore 2KZT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KZT contains 20 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	157-158	2
α-helix	161-178	18
α-helix	181-191	11
α-helix	195-198	4
α-helix	199-210	12
α-helix	213-226	14
β-strand	227	1	1
β-strand	231	1	1
α-helix	233-253	21
α-helix	257-271	15
α-helix	278-281	4
α-helix	289-305	17

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	321-325	5
α-helix	331-336	6
α-helix	337-341	5
α-helix	344-351	8
α-helix	358-360	3
α-helix	361-373	13
α-helix	377-392	16
α-helix	398-416	19
α-helix	423-436	14
α-helix	441-444	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Programmed cell death protein 4	A	protein	163	Homo sapiens	Q53EL6 (AlphaFold model)
Programmed cell death protein 4	B	protein	131	Mus musculus	Q61823 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KZT_1 Programmed cell death protein 4 (chains A)
GLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASH
REMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILC
NTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSG

Sequence of entity 2 (B), FASTA

>2KZT_2 Programmed cell death protein 4 (chains B)
GGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGES
AFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGI
ISKQLRDLCPS

Primary citation

Structure of the tandem MA-3 region of Pdcd4 protein and characterization of its interactions with eIF4A and eIF4G: molecular mechanisms of a tumor suppressor. Waters, L.C., Strong, S.L., Ferlemann, E. et al. J Biol Chem (2011) 286:17270-17280. DOI 10.1074/jbc.M110.166157 · PubMed

Other PDB entries of the same protein (UniProt Q53EL6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9TES 1.22 Å, Crystal structure of beta-TrCP bound by diphosphorylated PDCD4 degron peptide
2RG8 1.8 Å, Crystal Structure of Programmed for Cell Death 4 Middle MA3 domain
9BKD 2.6 Å, The structure of human Pdcd4 bound to the 40S small ribosomal subunit
2ZU6 2.8 Å, crystal structure of the eIF4A-PDCD4 complex
3EIJ 2.8 Å, Crystal structure of Pdcd4
8XXL 2.9 Å, Cryo-EM structure of the human 40S ribosome with PDCD4
8XXM 3.2 Å, Cryo-EM structure of the human 40S ribosome with PDCD4 and eIF3G
8XXN 3.6 Å, Cryo-EM structure of the human 43S ribosome with PDCD4
9BLN 3.9 Å, The structure of human Pdcd4 bound to the 40S-eIF4A-eIF3-eIF1 complex
2GGF Solution structure of the MA3 domain of human Programmed cell death 4

Browse structure collections

About this viewer

MolViewer shows 2KZT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.