2L11: Cbx3

Solution NMR structure of the Cbx3 in complex with H3K9me3 peptide. Determined by solution NMR. Released 4 Aug 2010.

Method: Solution NMR
Organisms: Homo sapiens, Xenopus laevis
Chains: 2
Atoms: 561
Mol. weight: 7.96 kDa
Released: 4 Aug 2010

Explore 2L11 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L11 contains 1 α-helix and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-14	13	1
β-strand	17-24	8	1
β-strand	34-36	3	1
β-strand	40	1	1
α-helix	43-53	11

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	5-8	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox protein homolog 3	A	protein	54	Homo sapiens	Q13185 (AlphaFold model)
Histone H3	B	protein	15	Xenopus laevis	P84233 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L11_1 Chromobox protein homolog 3 (chains A)
GEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQK

Sequence of entity 2 (B), FASTA

>2L11_2 Histone H3 (chains B)
ARTKQTARKSTGGKA

Primary citation

Recognition and specificity determinants of the human cbx chromodomains. Kaustov, L., Ouyang, H., Amaya, M. et al. J Biol Chem (2011) 286:521-529. DOI 10.1074/jbc.M110.191411 · PubMed

Other PDB entries of the same protein (UniProt Q13185 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5T1I 1.6 Å, CBX3 chromo shadow domain in complex with histone H3 peptide
3KUP 1.77 Å, Crystal Structure of the CBX3 Chromo Shadow Domain
9OSC 1.77 Å, Crystal structure of HP1gamma chromoshadow domain in complex with KAP1 peptide
8JZW 1.8 Å, Cystal structure of HP1 in complex with TRIM66 peptide
3TZD 1.81 Å, Crystal structure of the complex of Human Chromobox Homolog 3 (CBX3)
6HW2 1.94 Å, The Crystal Structure of CaV beta4c in complex with HP1gamma chromo shadow domains
3DM1 2.4 Å, Crystal structure of the complex of human chromobox homolog 3 (CBX3) with peptide

Browse structure collections

About this viewer

MolViewer shows 2L11 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.