3TZD: Complex of Human Chromobox Homolog 3

Crystal structure of the complex of Human Chromobox Homolog 3 (CBX3). Determined by X-ray diffraction at 1.81 Å resolution. Released 7 Mar 2012.

Method: X-ray diffraction
Resolution: 1.81 Å
Organism: Homo sapiens
Chains: 2
Atoms: 684
Mol. weight: 8.99 kDa
Released: 7 Mar 2012

Explore 3TZD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TZD contains 3 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	29-31	3	1
β-strand	32-41	10	2
β-strand	44-51	8	2
α-helix	56-58	3
β-strand	60-63	4	2
α-helix	64-66	3
β-strand	67-68	2	1
α-helix	70-80	11

Chain T: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	23-25	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox protein homolog 3	A	protein	58	Homo sapiens	Q13185 (AlphaFold model)
Histone H1.4	T	protein	19	Homo sapiens	P10412 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3TZD_1 Chromobox protein homolog 3 (chains A)
LYFQGEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQK

Sequence of entity 2 (T), FASTA

>3TZD_2 Histone H1.4 (chains T)
YPVKKKARKSAGAAKRKAS

Primary citation

Structural basis of the chromodomain of Cbx3 bound to methylated peptides from histone h1 and G9a. Ruan, J., Ouyang, H., Amaya, M.F. et al. PLoS One (2012) 7:e35376-e35376. DOI 10.1371/journal.pone.0035376 · PubMed

Other PDB entries of the same protein (UniProt Q13185 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5T1I 1.6 Å, CBX3 chromo shadow domain in complex with histone H3 peptide
3KUP 1.77 Å, Crystal Structure of the CBX3 Chromo Shadow Domain
9OSC 1.77 Å, Crystal structure of HP1gamma chromoshadow domain in complex with KAP1 peptide
8JZW 1.8 Å, Cystal structure of HP1 in complex with TRIM66 peptide
6HW2 1.94 Å, The Crystal Structure of CaV beta4c in complex with HP1gamma chromo shadow domains
3DM1 2.4 Å, Crystal structure of the complex of human chromobox homolog 3 (CBX3) with peptide
2L11 Solution NMR structure of the Cbx3 in complex with H3K9me3 peptide

Browse structure collections

About this viewer

MolViewer shows 3TZD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.