2L1L: Phi0 PKI NES Peptide

NMR Solution Structure of the Phi0 PKI NES Peptide in Complex with CRM1-RanGTP. Determined by solution NMR. Released 15 Jun 2011.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,228
Mol. weight: 17.56 kDa
Released: 15 Jun 2011

Explore 2L1L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L1L contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	7-14	8

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	510-530	21
α-helix	534-550	17
α-helix	552-557	6
α-helix	559-572	14
α-helix	580-594	15
α-helix	596-599	4
α-helix	602-603	2
α-helix	610-615	6
α-helix	618-622	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase inhibitor alpha	A	protein	27	Homo sapiens	P61925 (AlphaFold model)
Exportin-1	B	protein	127	Homo sapiens	O14980 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L1L_1 cAMP-dependent protein kinase inhibitor alpha (chains A)
GSASGNLNELALKLAGLDINKTEGEEC

Sequence of entity 2 (B), FASTA

>2L1L_2 Exportin-1 (chains B)
ISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLK
TVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIIC
DLQPQQV

Primary citation

NES consensus redefined by structures of PKI-type and Rev-type nuclear export signals bound to CRM1. Guttler, T., Madl, T., Neumann, P. et al. Nat Struct Mol Biol (2010) 17:1367-1376. DOI 10.1038/nsmb.1931 · PubMed

Other PDB entries of the same protein (UniProt P61925 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M6Y 1.37 Å, Cocrystal structure of cAMP-dependent Protein Kinase (PKA) in complex with a…
5M6V 1.42 Å, Cocrystal structure of cAMP-dependent Protein Kinase (PKA) in complex with a double…
5LCQ 1.42 Å, Cocrystal structure of cAMP-dependent Protein Kinase (PKA) in complex with long-chain…
5LCP 1.43 Å, Cocrystal structure of cAMP-dependent Protein Kinase (PKA) in complex with Fasudil (M77)
5M0L 1.47 Å, Cocrystal structure of cAMP-dependent Protein Kinase (PKA) in complex with the…
5M71 1.49 Å, Cocrystal structure of cAMP-dependent Protein Kinase (PKA) in complex with an (R)-methyl…
5M0B 1.51 Å, Cocrystal structure of cAMP-dependent Protein Kinase (PKA) in complex with a…
5M75 1.54 Å, Cocrystal structure of cAMP-dependent Protein Kinase (PKA) in complex with a (S)-methyl…
4IAI 1.55 Å, X-ray Structure of cAMP dependent protein kinase A in complex with high Ca2+…
4WB8 1.55 Å, Crystal structure of human cAMP-dependent protein kinase A (catalytic alpha subunit),…
9PC1 1.55 Å, Co-crystal structure of the cAMP-dependent protein kinase catalytic subunit alpha with…
4Z84 1.55 Å, PKAB3 in complex with pyrrolidine inhibitor 34a

Browse structure collections

About this viewer

MolViewer shows 2L1L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.