2L29: Insulin-like growth factor 2 receptor variant

Complex structure of E4 mutant human IGF2R domain 11 bound to IGF-II. Determined by solution NMR. Released 15 Feb 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,598
Mol. weight: 22.92 kDa
Released: 15 Feb 2012

Explore 2L29 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L29 contains 5 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	1517-1519	3	1
β-strand	1526-1528	3	1
β-strand	1538-1541	4	2
β-strand	1547-1550	4	2
β-strand	1563-1567	5	2
β-strand	1572-1576	5	2
β-strand	1580-1584	5	3
β-strand	1587-1592	6	3
α-helix	1596	1
β-strand	1597-1598	2	4
β-strand	1601	1	5
β-strand	1604-1605	2	4
β-strand	1607-1614	8	3
β-strand	1625-1630	6	3
β-strand	1635-1642	8	3
α-helix	1643-1645	3

Chain B: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	11-21	11
α-helix	45-48	4
β-strand	52	1	5
α-helix	53-59	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin-like growth factor 2 receptor variant	A	protein	142	Homo sapiens	P11717 (AlphaFold model)
Insulin-like growth factor II	B	protein	67	Homo sapiens	P01344 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L29_1 Insulin-like growth factor 2 receptor variant (chains A)
MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSKSGVVYMSICGENENCPPGVGACF
GQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLI
SLDKQTCTLFFSWHTPLACEPE

Sequence of entity 2 (B), FASTA

>2L29_2 Insulin-like growth factor II (chains B)
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYC
ATPAKSE

Primary citation

An exon splice enhancer primes IGF2:IGF2R binding site structure and function evolution. Williams, C., Hoppe, H.J., Rezgui, D. et al. Science (2012) 338:1209-1213. DOI 10.1126/science.1228633 · PubMed

Other PDB entries of the same protein (UniProt P11717 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GP0 1.4 Å, Human IGF2R domain 11
6Z30 1.5 Å, Human cation-independent mannose 6-phosphate/ IGF2 receptor domains 9-10
1E6F 1.75 Å, Human MIR-receptor, repeat 11
1GQB 1.8 Å, Human mir-receptor, repeat 11
1GP3 1.95 Å, Human IGF2R domain 11
1JWG 2.0 Å, VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide
6N5X 2.05 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
6N5Y 2.26 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
1LF8 2.3 Å, Complex of GGA3-VHS Domain and CI-MPR C-terminal Phosphopeptide
1JPL 2.4 Å, GGA3 VHS domain complexed with C-terminal peptide from cation-independent mannose…
6V02 2.46 Å, N-terminal 5 domains of CI-MPR
6P8I 2.54 Å, N-terminal 5 domains of IGFIIR

Browse structure collections

About this viewer

MolViewer shows 2L29 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.