Solution NMR Structure of CH domain of Rho guanine nucleotide exchange factor 7 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4495E. Determined by solution NMR. Released 15 Dec 2010.
Explore 2L3G in 3D Show helices and sheets RCSB PDB PDBe
2L3G contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 13-23 | 11 | |
| α-helix | 28-30 | 3 | |
| α-helix | 37-45 | 9 | |
| α-helix | 49-58 | 10 | |
| α-helix | 73-89 | 17 | |
| α-helix | 98-102 | 5 | |
| α-helix | 107-124 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rho guanine nucleotide exchange factor 7 | A | protein | 126 | Homo sapiens | Q14155 (AlphaFold model) |
>2L3G_1 Rho guanine nucleotide exchange factor 7 (chains A) MGHHHHHHSHMNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLP GTIEKVYPEPRSESECLSNIREFLRGCGASLRLETFDANDLYQGQNFNKVLSSLVTLNKV TADIGL
Northeast Structural Genomics Consortium Target HR4495E. Liu, G., Xiao, R., Janjua, H. et al. To be published.
Other PDB entries of the same protein (UniProt Q14155 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2L3G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.