beta PIX-SH3 complexed with an atypical peptide from alpha-PAK. Determined by solution NMR. Released 30 Aug 2005.
Explore 1ZSG in 3D Show helices and sheets RCSB PDB PDBe
1ZSG contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-13 | 4 | 1 |
| β-strand | 17 | 1 | 2 |
| β-strand | 24 | 1 | 1 |
| α-helix | 25-26 | 2 | |
| β-strand | 27 | 1 | 2 |
| β-strand | 32-37 | 6 | 1 |
| β-strand | 43-48 | 6 | 1 |
| β-strand | 51-56 | 6 | 1 |
| β-strand | 60-62 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rho guanine nucleotide exchange factor 7 | A | protein | 65 | Homo sapiens | Q14155 (AlphaFold model) |
| Serine/threonine-protein kinase PAK 1 | B | protein | 22 | Q13153 (AlphaFold model) |
>1ZSG_1 Rho guanine nucleotide exchange factor 7 (chains A) MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYV REVKA
>1ZSG_2 Serine/threonine-protein kinase PAK 1 (chains B) DATPPPVIAPRPEHTKSVYTRS
Structural Analysis of the SH3 Domain of beta-PIX and Its Interaction with alpha-p21 Activated Kinase (PAK). Mott, H.R., Nietlispach, D., Evetts, K.A. et al. Biochemistry (2005) 44:10977-10983. DOI 10.1021/bi050374a · PubMed
Other PDB entries of the same protein (UniProt Q14155 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1ZSG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.