2L3H: Prostatic acid phosphatase

NMR Structure in a Membrane Environment Reveals Putative Amyloidogenic Regions of the SEVI Precursor Peptide PAP248-286. Determined by solution NMR. Released 6 Oct 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 319
Mol. weight: 4.56 kDa
Released: 6 Oct 2010

Explore 2L3H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L3H contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	262-268	7
α-helix	282-284	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prostatic acid phosphatase	A	protein	39	Homo sapiens	P15309 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L3H_1 Prostatic acid phosphatase (chains A)
GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY

Primary citation

NMR structure in a membrane environment reveals putative amyloidogenic regions of the SEVI precursor peptide PAP(248-286). Nanga, R.P., Brender, J.R., Vivekanandan, S. et al. J Am Chem Soc (2009) 131:17972-17979. DOI 10.1021/ja908170s · PubMed

Other PDB entries of the same protein (UniProt P15309 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PPD 1.5 Å, GGVLVN segment from Human Prostatic Acid Phosphatase Residues 260-265, involved in…
9NMV 1.97 Å, TCR156 S32Halpha bound to HLA A*02:01-PAP
9NMY 2.01 Å, TCR156 S32Qalpha bound to HLA A*02:01-PAP
9NMU 2.1 Å, TCR156 bound to HLA A*02:01-PAP
9NMW 2.11 Å, TCR156 S30Ealpha S32Qalpha bound to HLA A*02:01-PAP
9NMX 2.19 Å, TCR156 S32Malpha variant bound to HLA A*02:01-PAP
1ND6 2.4 Å, Crystal Structures of Human Prostatic Acid Phosphatase in Complex with a Phosphate Ion…
9YTD 2.5 Å, Designed antibody vAB66 targeting PAP-HLA A*02:01
1ND5 2.9 Å, Crystal Structures of Human Prostatic Acid Phosphatase in Complex with a Phosphate Ion…
2HPA 2.9 Å, Structural origins of L(+)-tartrate inhibition of human prostatic acid phosphatase
8XJ4 3.19 Å, Structure of prostatic acid phosphatase in human semen
1CVI 3.2 Å, Crystal structure of human prostatic acid phosphatase

Browse structure collections

About this viewer

MolViewer shows 2L3H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.