Solution structures of human PIWI-like 1 PAZ domain. Determined by solution NMR. Released 20 Apr 2011.
Explore 2L5C in 3D Show helices and sheets RCSB PDB PDBe
2L5C contains 5 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 278 | 1 | 1 |
| α-helix | 279-287 | 9 | |
| α-helix | 293-303 | 11 | |
| β-strand | 306-310 | 5 | 1 |
| β-strand | 315-323 | 9 | 1 |
| β-strand | 331-333 | 3 | 2 |
| β-strand | 339-341 | 3 | 2 |
| α-helix | 342-343 | 2 | |
| α-helix | 344-348 | 5 | |
| α-helix | 349 | 1 | |
| β-strand | 361-365 | 5 | 1 |
| β-strand | 380-382 | 3 | 1 |
| β-strand | 387-389 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Piwi-like protein 1 | A | protein | 134 | Homo sapiens | Q96J94 (AlphaFold model) |
>2L5C_1 Piwi-like protein 1 (chains A) CTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWD QNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPGGTLPGPAMLIPE LCYLTGLTDKMRND
Structural insights into piRNA recognition by the human PIWI-like 1 PAZ domain. Zeng, L., Zhang, Q., Yan, K. et al. Proteins (2011) 79:2004-2009. DOI 10.1002/prot.23003 · PubMed
Other PDB entries of the same protein (UniProt Q96J94 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2L5C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.