2L5V: C-terminal domain of hRpn13

Solution structure of the C-terminal domain of hRpn13. Determined by solution NMR. Released 9 Nov 2011.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,104
Mol. weight: 15.8 kDa
Released: 9 Nov 2011

Explore 2L5V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L5V contains 14 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	265-269	5
α-helix	270-272	3
α-helix	276-279	4
α-helix	288-290	3
α-helix	294-301	8
α-helix	304-310	7
α-helix	311-313	3
α-helix	314-315	2
α-helix	324-330	7
α-helix	334-345	12
α-helix	346-350	5
α-helix	354-358	5
α-helix	363-371	9
α-helix	374-385	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proteasomal ubiquitin receptor ADRM1	A	protein	150	Homo sapiens	Q16186 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L5V_1 Proteasomal ubiquitin receptor ADRM1 (chains A)
GSQPIQLSDLQSILATMNVPAGPAGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSG
ESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAF
AKAMQNNAKPEQKEGDTKDKKDEEEDMSLD

Primary citation

Solution structure of the C-terminal domain of hRpn13. Zhou, Z., Hu, H. To be published.

Other PDB entries of the same protein (UniProt Q16186 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5V1Y 1.42 Å, Crystal structure of the ternary RPN13 PRU-RPN2 (940-953)-ubiquitin complex
6OI4 1.76 Å, RPN13 (19-132)-RPN2 (940-952) pY950-Ub complex
5IRS 1.8 Å, crystal structure of the proteasomal Rpn13 PRU-domain
8VWO 1.85 Å, Crystal structure of hRpn13 Pru bound with U-shaped peptide
4WLR 2.0 Å, Crystal Structure of mUCH37-hRPN13 CTD-hUb complex
5V1Z 2.0 Å, Crystal structure of the RPN13 PRU-RPN2 (932-953)-ubiquitin complex
8FTQ 2.1 Å, Crystal structure of hRpn13 Pru domain in complex with Ubiquitin and XL44
4UEL 2.3 Å, UCH-L5 in complex with ubiquitin-propargyl bound to the RPN13 DEUBAD domain
9E7K 2.41 Å, Crystal structure of the UCH37 RPN13 DEUBAD complex bound to an inhibitory nanobody in…
4UEM 2.82 Å, UCH-L5 in complex with the RPN13 DEUBAD domain
4WLQ 2.85 Å, Crystal structure of mUCH37-hRPN13 CTD complex
2KQZ Solution structure of the Rpn13 DEUBAD domain

Browse structure collections

About this viewer

MolViewer shows 2L5V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.