Solution NMR structure of PAP248-286 in 50% TFE. Determined by solution NMR. Released 29 Dec 2010.
Explore 2L77 in 3D Show helices and sheets RCSB PDB PDBe
2L77 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-8 | 3 | |
| α-helix | 12-29 | 18 | |
| α-helix | 33-37 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Prostatic acid phosphatase | A | protein | 39 | Homo sapiens | P15309 (AlphaFold model) |
>2L77_1 Prostatic acid phosphatase (chains A) GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
Solution NMR structure of PAP248-286 in TFE. Brender, J.R., Nanga, R., Popovych, N. et al. To be published.
Other PDB entries of the same protein (UniProt P15309 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2L77 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.