2L7P: ASHH2 a CW domain

ASHH2 a CW domain. Determined by solution NMR. Released 11 May 2011.

Method: Solution NMR
Organism: Arabidopsis thaliana
Chains: 1
Atoms: 780
Mol. weight: 11.28 kDa
Ligands: ZN
Released: 11 May 2011

Explore 2L7P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L7P contains 3 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	27-30	4	1
β-strand	37-40	4	1
α-helix	42-45	4
α-helix	56-58	3
α-helix	75-82	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone-lysine N-methyltransferase ASHH2	A	protein	100	Arabidopsis thaliana	Q2LAE1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L7P_1 Histone-lysine N-methyltransferase ASHH2 (chains A)
GSRRASVGSEFMVVDVTIEDSYSTESAWVRCDDCFKWRRIPASVVGSIDESSRWICMNNS
DKRFADCSKSQEMSNEEINEELGIGQDEADAYDCDAAKRG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

The CW domain, a new histone recognition module in chromatin proteins. Hoppmann, V., Thorstensen, T., Kristiansen, P.E. et al. EMBO J (2011) 30:1939-1952. DOI 10.1038/emboj.2011.108 · PubMed

Other PDB entries of the same protein (UniProt Q2LAE1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YVX 1.59 Å, Crystal structure of SDG8 CW domain in complex with H3K4me1 peptide
6QXZ Solution structure of the ASHH2 CW domain with the N-terminal histone H3 tail mimicking…

Browse structure collections

About this viewer

MolViewer shows 2L7P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.