2L8B: TraI

TraI (381-569). Determined by solution NMR. Released 11 Jan 2012.

Method: Solution NMR
Organism: Escherichia coli
Chains: 1
Atoms: 1,430
Mol. weight: 20.49 kDa
Released: 11 Jan 2012

Explore 2L8B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L8B contains 7 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	390-403	14
α-helix	409-411	3
α-helix	416-429	14
β-strand	433-434	2	1
β-strand	437	1	1
α-helix	443-458	16
β-strand	463-466	4	1
α-helix	471-476	6
β-strand	504-509	6	1
α-helix	513-527	15
β-strand	532-536	5	1
α-helix	544-552	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein traI	A	protein	189	Escherichia coli	P14565 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L8B_1 Protein traI (chains A)
TSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYSDAVSVLAQDRPSLAIVSGQG
GAAGQRERVAELVMMAREQGREVQIIAADRRSQMNMKQDERLSGELITGRRQLLEGMAFT
PGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPAT

Primary citation

Solution structure and small angle scattering analysis of TraI (381-569). Wright, N.T., Raththagala, M., Hemmis, C.W. et al. Proteins (2012) 80:2250-2261. DOI 10.1002/prot.24114 · PubMed

Other PDB entries of the same protein (UniProt P14565 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FLD 2.4 Å, Crystal structure of the trai c-terminal domain
2Q7T 2.42 Å, Crystal Structure of the F plasmid TraI Relaxase Domain with the Scissile Thymidine Base
1P4D 2.6 Å, F factor TraI Relaxase Domain
2A0I 2.72 Å, F Factor TraI Relaxase Domain bound to F oriT Single-stranded DNA
9F10 2.94 Å, CryoEM structure of the F plasmid relaxosome with TraI in its TE mode, without accessory…
2Q7U 3.0 Å, Crystal Structure of the F plasmid TraI Relaxase Domain with the Scissile Thymidine Base…
9F0Z 3.42 Å, CryoEM structure of the F plasmid relaxosome with truncated TraI1-863 in its TE mode,…
9F12 3.42 Å, CryoEM structure of the F plasmid relaxosome with oriT DNA ss-27_-3ds-2_+143 and TraI…
9F0Y 3.45 Å, CryoEM structure of the F plasmid relaxosome with TraI in its TE mode, derived from the…
9F11 3.68 Å, CryoEM structure of the F plasmid relaxosome with oriT DNA ss-27_+3ds+4_+143 and TraI…
9F0X 3.78 Å, CryoEM structure of the F plasmid relaxosome in its pre-initiation state, derived from…

Browse structure collections

About this viewer

MolViewer shows 2L8B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.