Structure of the second WW domain from human YAP in complex with a human Smad1 derived peptide. Determined by solution NMR. Released 6 Jul 2011.
Explore 2LAW in 3D Show helices and sheets RCSB PDB PDBe
2LAW contains 0 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 238-241 | 4 | 1 |
| β-strand | 245-250 | 6 | 1 |
| β-strand | 255-257 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Yorkie homolog | A | protein | 38 | Homo sapiens | P46937 (AlphaFold model) |
| Mothers against decapentaplegic homolog 1 | B | protein | 12 | Homo sapiens | Q15797 (AlphaFold model) |
>2LAW_1 Yorkie homolog (chains A) GAMEGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRL
>2LAW_2 Mothers against decapentaplegic homolog 1 (chains B) TPPPAYLPPEDP
A Smad action turnover switch operated by WW domain readers of a phosphoserine code. Aragon, E., Goerner, N., Zaromytidou, A.I. et al. Genes Dev (2011) 25:1275-1288. DOI 10.1101/gad.2060811 · PubMed
Other PDB entries of the same protein (UniProt P46937 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2LAW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.