2LAY: First WW domain of human YAP

Structure of the first WW domain of human YAP in complex with a phosphorylated human Smad1 derived peptide. Determined by solution NMR. Released 6 Jul 2011.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 366
Mol. weight: 5.21 kDa
Released: 6 Jul 2011

Explore 2LAY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LAY contains 0 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	177-182	6	1
β-strand	186-191	6	1
β-strand	196-198	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Yorkie homolog	A	protein	36	Homo sapiens	P46937 (AlphaFold model)
Mothers against decapentaplegic homolog 1	B	protein	9	Homo sapiens	Q15797 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LAY_1 Yorkie homolog (chains A)
DVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKA

Sequence of entity 2 (B), FASTA

>2LAY_2 Mothers against decapentaplegic homolog 1 (chains B)
STYPHSPTS

Primary citation

A Smad action turnover switch operated by WW domain readers of a phosphoserine code. Aragon, E., Goerner, N., Zaromytidou, A.I. et al. Genes Dev (2011) 25:1275-1288. DOI 10.1101/gad.2060811 · PubMed

Other PDB entries of the same protein (UniProt P46937 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6G6X 1.13 Å, 14-3-3sigma in complex with a P129beta3P mutated YAP pS127 phosphopeptide
3MHR 1.15 Å, 14-3-3 sigma in complex with YAP pS127-peptide
7O07 1.2 Å, 14-3-3sigma covalently bound to peptide (chloroacetamide-Cys interaction)
6G8K 1.25 Å, 14-3-3sigma in complex with a S131beta3S mutated YAP pS127 phosphopeptide
6G8L 1.37 Å, 14-3-3sigma in complex with a L132beta3L mutated YAP pS127 phosphopeptide
8A8Q 1.47 Å, Crystal structure of Protein Scalloped in complex with YAP peptide
6G8J 1.47 Å, 14-3-3sigma in complex with a A130beta3A mutated YAP pS127 phosphopeptide
4REX 1.6 Å, Crystal structure of the first WW domain of human YAP2 isoform
6G8I 1.6 Å, 14-3-3sigma in complex with a R124beta3R mutated YAP pS127 phosphopeptide
6GEI 1.65 Å, TEAD4 (216-434);E263A+Y429F complexed with yap peptide (60- 100);S94A and myristoate…
6HIK 1.65 Å, X-ray structure of TEAD4(Y429H) mutant) complexed with YAP (wildtype): Molecular and…
8A8R 1.7 Å, Crystal structure of TEAD4 in complex with YAP peptide

Browse structure collections

About this viewer

MolViewer shows 2LAY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.