2LD1: Transcriptional regulator ATRX

Structures and chemical shift assignments for the ADD domain of the ATRX protein. Determined by solution NMR. Released 8 Jun 2011.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,131
Mol. weight: 16.47 kDa
Ligands: ZN
Released: 8 Jun 2011

Explore 2LD1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LD1 contains 4 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	170-171	2	1
β-strand	176-177	2	1
β-strand	187-188	2	2
β-strand	195-196	2	2
α-helix	198-206	9
β-strand	212	1	3
β-strand	216	1	3
β-strand	229-231	3	4
β-strand	238-240	3	4
α-helix	241-248	8
α-helix	251-256	6
α-helix	274-292	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcriptional regulator ATRX	A	protein	142	Homo sapiens	P46100 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LD1_1 Transcriptional regulator ATRX (chains A)
GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSD
GMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLL
DLVTACNSVFENLEQLLQQNKK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

Structural consequences of disease-causing mutations in the ATRX-DNMT3-DNMT3L (ADD) domain of the chromatin-associated protein ATRX. Argentaro, A., Yang, J.C., Chapman, L. et al. Proc Natl Acad Sci U S A (2007) 104:11939-11944. DOI 10.1073/pnas.0704057104 · PubMed

Other PDB entries of the same protein (UniProt P46100 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3QL9 0.93 Å, Monoclinic complex structure of ATRX ADD bound to histone H3K9me3 peptide
6G0O 1.4 Å, Crystal Structure of the first bromodomain of human BRD4 in complex with an acetylated…
5GRQ 1.58 Å, Crystal Structure of DHB domain of Daxx in complex with an ATRX peptide
3QLA 1.6 Å, Hexagonal complex structure of ATRX ADD bound to H3K9me3 peptide
3QLN 1.9 Å, Crystal structure of ATRX ADD domain in free state
5Y18 2.2 Å, Crystal structure of DAXX helical bundle domain in complex with ATRX
3QLC 2.5 Å, Complex structure of ATRX ADD domain bound to unmodified H3 1-15 peptide
4W5A 2.6 Å, Complex structure of ATRX ADD bound to H3K9me3S10ph peptide
5Y6O 3.1 Å, Crystal structure of DAXX N-terminal four-helix bundle domain (4HB) in complex with ATRX
9L06 3.4 Å, The cryo-EM structure of ATRX in complex with the nucleosome in the ADP.BeFx-bound state…
2JM1 Structures and chemical shift assignments for the ADD domain of the ATRX protein
2LBM Solution structure of the ADD domain of ATRX complexed with histone tail H3 1-15 K9me3

Browse structure collections

About this viewer

MolViewer shows 2LD1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.