5Y18: DAXX helical bundle domain

Crystal structure of DAXX helical bundle domain in complex with ATRX. Determined by X-ray diffraction at 2.2 Å resolution. Released 30 May 2018.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 866
Mol. weight: 13.68 kDa
Released: 30 May 2018

Explore 5Y18 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5Y18 contains 7 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	59-77	19
α-helix	84-93	10
β-strand	95	1	1
α-helix	97-100	4
α-helix	103-118	16
α-helix	120-122	3
α-helix	123-136	14
β-strand	138	1	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1268-1282	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Death domain-associated protein 6	A	protein	95	Homo sapiens	Q9UER7 (AlphaFold model)
Transcriptional regulator ATRX	B	protein	23	Homo sapiens	P46100 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5Y18_1 Death domain-associated protein 6 (chains A)
GPLGSGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNIL
SRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLN

Sequence of entity 2 (B), FASTA

>5Y18_2 Transcriptional regulator ATRX (chains B)
SENRIAKKMLLEEIKANLSSDED

Primary citation

Structural basis for DAXX interaction with ATRX. Wang, X., Zhao, Y., Zhang, J. et al. Protein Cell (2017) 8:767-771. DOI 10.1007/s13238-017-0462-y · PubMed

Other PDB entries of the same protein (UniProt Q9UER7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GRQ 1.58 Å, Crystal Structure of DHB domain of Daxx in complex with an ATRX peptide
4H9N 1.95 Å, Complex structure 1 of DAXX/H3.3(sub5)/H4
4H9Q 1.95 Å, Complex structure 4 of DAXX(E225A)/H3.3(sub5)/H4
4H9O 2.05 Å, Complex structure 2 of DAXX/H3.3(sub5,G90M)/H4
4H9R 2.2 Å, Complex structure 5 of DAXX(E225A)/H3.3(sub5,G90A)/H4
4H9P 2.2 Å, Complex structure 3 of DAXX/H3.3(sub5,G90A)/H4
4H9S 2.6 Å, Complex structure 6 of DAXX/H3.3(sub7)/H4
4HGA 2.8 Å, Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX
5Y6O 3.1 Å, Crystal structure of DAXX N-terminal four-helix bundle domain (4HB) in complex with ATRX
5KDM 3.5 Å, Crystal structure of EBV tegument protein BNRF1 in complex with histone chaperone DAXX…
2KQS Phosphorylation of SUMO-interacting motif by CK2 enhances Daxx SUMO binding activity
2KZS DAXX helical bundle (DHB) domain

Browse structure collections

About this viewer

MolViewer shows 5Y18 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.