2LE4: Transcription factor SOX-2

Name: PDB 2LE4: Solution structure of the HMG box DNA-binding domain of human stem cell transcription factor Sox2
Published: 2011-07-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Solution structure of the HMG box DNA-binding domain of human stem cell transcription factor Sox2. Determined by solution NMR. Released 27 Jul 2011.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 694
Mol. weight: 9.92 kDa
Released: 27 Jul 2011

Explore 2LE4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LE4 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	10-25	16
α-helix	32-43	12
α-helix	47-65	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor SOX-2	A	protein	81	Homo sapiens	P48431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LE4_1 Transcription factor SOX-2 (chains A)
SDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRL
RALHMKEHPDYKYRPRRKTKT

Primary citation

Solution structure of the HMG box DNA-binding domain of human stem cell transcription factor Sox2. Sahu, S., Markley, J., Tonelli, M. et al. To be published.

Other PDB entries of the same protein (UniProt P48431 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WX8 2.3 Å, SOX2 bound to Importin-alpha 3
6WX7 2.7 Å, SOX2 bound to Importin-alpha 2
6WX9 2.8 Å, SOX2 bound to Importin-alpha 5
6T90 3.05 Å, OCT4-SOX2-bound nucleosome - SHL-6
6YOV 3.42 Å, OCT4-SOX2-bound nucleosome - SHL+6
9RL4 3.5 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL-6
9RN2 4.1 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 2
9RMC 4.2 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 1
6T7B 5.1 Å, Structure of human Sox2 transcription factor in complex with a nucleosome
9RN1 5.9 Å, Structure of BAF-nucleosome complex with OCT4-SOX2 at SHL+6 in ADP-bound state, BAF47…
1O4X Ternary complex of the DNA binding domains of the OCT1 and SOX2 transcription factors…
9QPF Solution structure of Sox2 DBD

Browse structure collections

About this viewer

MolViewer shows 2LE4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.