2LEH: Core SMN-Gemin2 complex

Solution structure of the core SMN-Gemin2 complex. Determined by solution NMR. Released 27 Jun 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,722
Mol. weight: 24.47 kDa
Released: 27 Jun 2012

Explore 2LEH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LEH contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	100-125	26
α-helix	141-149	9
α-helix	152-155	4
α-helix	180-185	6
α-helix	188-201	14
α-helix	210-221	12
α-helix	226-227	2
α-helix	228-247	20
α-helix	256-269	14

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	38-48	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Survival of motor neuron protein-interacting protein 1	A	protein	189	Homo sapiens	O14893 (AlphaFold model)
Survival motor neuron protein	B	protein	26	Homo sapiens	Q16637 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LEH_1 Survival of motor neuron protein-interacting protein 1 (chains A)
GYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLC
ADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRW
LYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRD
LADEPSLEY

Sequence of entity 2 (B), FASTA

>2LEH_2 Survival motor neuron protein (chains B)
GQSDDSDIWDDTALIKAYDKAVASFK

Primary citation

Solution structure of the core SMN-Gemin2 complex. Sarachan, K.L., Valentine, K.G., Gupta, K. et al. Biochem J (2012) 445:361-370. DOI 10.1042/BJ20120241 · PubMed

Other PDB entries of the same protein (UniProt O14893 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5XJL 2.5 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2 in Complex with…
5XJU 2.58 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2dN39 in Complex with…
5XJT 2.92 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2 in Complex with…
5XJR 3.12 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2dN39 in Complex with…
5XJQ 3.28 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2 in Complex with…
5XJS 3.38 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2dN39 in Complex with…

Browse structure collections

About this viewer

MolViewer shows 2LEH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.