5XJL: Gemin2-binding domain of SMN, Gemin2
Crystal Structure of the Gemin2-binding domain of SMN, Gemin2 in Complex with SmD1/D2/F/E/G from Human. Determined by X-ray diffraction at 2.5 Å resolution. Released 2 May 2018.
- Method
- X-ray diffraction
- Resolution
- 2.5 Å
- Organism
- Homo sapiens
- Chains
- 7
- Atoms
- 4,826
- Mol. weight
- 91.59 kDa
- Released
- 2 May 2018
Explore 5XJL in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5XJL contains 27 α-helices and 28 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain 2: 15 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 49-61 | 13 | |
| β-strand | 67-68 | 2 | 1 |
| β-strand | 83-84 | 2 | 2 |
| α-helix | 85-87 | 3 | |
| α-helix | 89-93 | 5 | |
| α-helix | 98-99 | 2 | |
| α-helix | 100-120 | 21 | |
| α-helix | 141-149 | 9 | |
| α-helix | 180-183 | 4 | |
| α-helix | 188-204 | 17 | |
| α-helix | 209-221 | 13 | |
| α-helix | 222-223 | 2 | |
| α-helix | 226-227 | 2 | |
| α-helix | 228-244 | 17 | |
| α-helix | 255-264 | 10 | |
| α-helix | 265-269 | 5 | |
| α-helix | 273-275 | 3 | |
Chain A: 4 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-7 | 4 | |
| β-strand | 14-19 | 6 | 1 |
| β-strand | 24-32 | 9 | 1 |
| β-strand | 38-47 | 10 | 1 |
| β-strand | 50-60 | 11 | 1 |
| α-helix | 62-64 | 3 | |
| β-strand | 65-69 | 5 | 1 |
| α-helix | 70-71 | 2 | |
| α-helix | 76-79 | 4 | |
Chain B: 2 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 30-38 | 9 | |
| β-strand | 41-46 | 6 | 1 |
| β-strand | 51-59 | 9 | 1 |
| β-strand | 65-76 | 12 | 1 |
| β-strand | 90-101 | 12 | 1 |
| α-helix | 103-105 | 3 | |
| β-strand | 106-110 | 5 | 1 |
| β-strand | 115-116 | 2 | 2 |
Chain E: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-27 | 11 | |
| β-strand | 30-35 | 6 | 1 |
| β-strand | 41-50 | 10 | 1 |
| β-strand | 56-65 | 10 | 1 |
| β-strand | 71-79 | 9 | 1 |
| α-helix | 81-83 | 3 | |
| β-strand | 84-89 | 6 | 1 |
Chain F: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-14 | 8 | |
| β-strand | 18-23 | 6 | 1 |
| β-strand | 28-36 | 9 | 1 |
| β-strand | 42-51 | 10 | 1 |
| β-strand | 54-64 | 11 | 1 |
| α-helix | 66-68 | 3 | |
| β-strand | 69-74 | 6 | 1 |
Chain G: 1 helix, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-12 | 4 | |
| β-strand | 16-21 | 6 | 1 |
| β-strand | 25-34 | 10 | 1 |
| β-strand | 40-47 | 8 | 1 |
| β-strand | 56-62 | 7 | 1 |
| β-strand | 67-71 | 5 | 1 |
Chain M: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 38-48 | 11 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Gem-associated protein 2 | 2 | protein | 280 | Homo sapiens | O14893 (AlphaFold model) |
| Small nuclear ribonucleoprotein Sm D1 | A | protein | 119 | Homo sapiens | P62314 (AlphaFold model) |
| Small nuclear ribonucleoprotein Sm D2 | B | protein | 118 | Homo sapiens | P62316 (AlphaFold model) |
| Small nuclear ribonucleoprotein E | E | protein | 92 | Homo sapiens | P62304 (AlphaFold model) |
| Small nuclear ribonucleoprotein F | F | protein | 86 | Homo sapiens | P62306 |
| Small nuclear ribonucleoprotein G | G | protein | 76 | Homo sapiens | P62308 |
| Survival motor neuron protein | M | protein | 37 | Homo sapiens | Q16637 |
Sequence of entity 1 (2), FASTA
>5XJL_1 Gem-associated protein 2 (chains 2)
MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEA
AQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKH
RSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLL
SIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARR
CSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
Sequence of entity 2 (A), FASTA
>5XJL_2 Small nuclear ribonucleoprotein Sm D1 (chains A)
MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSI
RGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
Sequence of entity 3 (B), FASTA
>5XJL_3 Small nuclear ribonucleoprotein Sm D2 (chains B)
MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFD
RHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
Sequence of entity 4 (E), FASTA
>5XJL_4 Small nuclear ribonucleoprotein E (chains E)
MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDD
AEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN
Sequence of entity 5 (F), FASTA
>5XJL_5 Small nuclear ribonucleoprotein F (chains F)
MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLG
EVLIRCNNVLYIRGVEEEEEDGEMRE
Sequence of entity 6 (G), FASTA
>5XJL_6 Small nuclear ribonucleoprotein G (chains G)
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMV
VIRGNSIIMLEALERV
Sequence of entity 7 (M), FASTA
>5XJL_7 Survival motor neuron protein (chains M)
GQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICET
Primary citation
Structure of a key intermediate of the SMN complex reveals Gemin2's crucial function in snRNP assembly. Zhang, R., So, B.R., Li, P. et al. Cell (2011) 146:384-395. DOI 10.1016/j.cell.2011.06.043 · PubMed
Other PDB entries of the same protein (UniProt O14893 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5XJU 2.58 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2dN39 in Complex with…
- 5XJT 2.92 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2 in Complex with…
- 5XJR 3.12 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2dN39 in Complex with…
- 5XJQ 3.28 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2 in Complex with…
- 5XJS 3.38 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2dN39 in Complex with…
- 2LEH Solution structure of the core SMN-Gemin2 complex
Browse structure collections
About this viewer
MolViewer shows 5XJL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.