2LFU: Gna2132

The structure of a N. meningitides protein targeted for vaccine development. Determined by solution NMR. Released 19 Oct 2011.

Method: Solution NMR
Organism: Neisseria meningitidis
Chains: 1
Atoms: 1,226
Mol. weight: 20.64 kDa
Released: 19 Oct 2011

Explore 2LFU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LFU contains 0 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	289-293	5	1
β-strand	299-303	5	1
β-strand	316-325	10	2
β-strand	336-345	10	2
β-strand	350-356	7	2
β-strand	366-372	7	2
β-strand	376-381	6	2
β-strand	387-393	7	2
β-strand	400-407	8	2
β-strand	419-424	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gna2132	A	protein	193	Neisseria meningitidis	Q9JPP1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LFU_1 Gna2132 (chains A)
MASLPAEMPLIPVNQADTLIVDGEAVSLTGHSGNIFAPEGNYRYLTYGAEKLPGGSYALR
VQGEPAKGEMLAGTAVYNGEVLHFHTENGRPYPTRGRFAAKVDFGSKSVDGIIDSGDDLH
MGTQKFKAAIDGNGFKGTWTENGGGDVSGRFYGPAGEEVAGKYSYRPTDAEKGGFGVFAG
KKEQDLEHHHHHH

Primary citation

Structure of the C-terminal Domain of Neisseria Heparin Binding Antigen (NHBA), One of the Main Antigens of a Novel Vaccine against Neisseria meningitidis. Esposito, V., Musi, V., de Chiara, C. et al. J Biol Chem (2011) 286:41767-41775. DOI 10.1074/jbc.M111.289314 · PubMed

Other PDB entries of the same protein (UniProt Q9JPP1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6CUJ 1.8 Å, Crystal structure of the C-terminal domain of neisserial heparin binding antigen (NHBA)
5O1R 2.86 Å, human Fab 5H2 bound to NHBA-C3 from Neisseria meningitidis serogroup B

Browse structure collections

About this viewer

MolViewer shows 2LFU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.