6CUJ: Gna2132

Crystal structure of the C-terminal domain of neisserial heparin binding antigen (NHBA). Determined by X-ray diffraction at 1.8 Å resolution. Released 26 Sept 2018.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Neisseria meningitidis
Chains: 2
Atoms: 2,367
Mol. weight: 34.75 kDa
Released: 26 Sept 2018

Explore 6CUJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6CUJ contains 5 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	277-278	2	1
β-strand	287-294	8	1
β-strand	298-305	8	1
β-strand	307	1	2
α-helix	308-309	2
α-helix	310-312	3
β-strand	316-329	14	2
β-strand	334-345	12	2
β-strand	350-356	7	2
β-strand	365-373	9	2
β-strand	376-381	6	2
β-strand	386	1	3
β-strand	389-394	6	2
β-strand	400-407	8	2
β-strand	408	1	3
β-strand	415-424	10	2

Chain B: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	287-293	7	1
α-helix	294	1
β-strand	299-305	7	1
β-strand	307	1	4
α-helix	308-309	2
α-helix	310-312	3
β-strand	316-329	14	4
β-strand	332-345	14	4
β-strand	350-356	7	4
β-strand	365-373	9	4
β-strand	376-381	6	4
β-strand	389-394	6	4
β-strand	400-407	8	4
β-strand	416-424	9	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gna2132	A, B	protein	161	Neisseria meningitidis	Q9JPP1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6CUJ_1 Gna2132 (chains A, B)
GNIFAPEGNYRYLTYGAEKLPGGSYALRVQGEPAKGEMLAGTAVYNGEVLHFHTENGRPY
PTRGRFAAKVDFGSKSVDGIIDSGDDLHMGTQKFKAAIDGNGFKGTWTENGGGDVSGRFY
GPAGEEVAGKYSYRPTDAEKGGFGVFAGKKEQDLEHHHHHH

Primary citation

Structures of NHBA elucidate a broadly conserved epitope identified by a vaccine induced antibody. Maritan, M., Veggi, D., Cozzi, R. et al. PLoS One (2018) 13:e0201922-e0201922. DOI 10.1371/journal.pone.0201922 · PubMed

Other PDB entries of the same protein (UniProt Q9JPP1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5O1R 2.86 Å, human Fab 5H2 bound to NHBA-C3 from Neisseria meningitidis serogroup B
2LFU The structure of a N. meningitides protein targeted for vaccine development

Browse structure collections

About this viewer

MolViewer shows 6CUJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.