2LGZ: STT3P

Solution structure of STT3P. Determined by solution NMR. Released 1 Aug 2012.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 2,216
Mol. weight: 31.41 kDa
Released: 1 Aug 2012

Explore 2LGZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LGZ contains 13 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	22-25	4
α-helix	27-29	3
α-helix	46-58	13
α-helix	67-76	10
α-helix	91-106	16
α-helix	115-128	14
α-helix	156-161	6
α-helix	176-188	13
α-helix	201-207	7
α-helix	221-225	5
α-helix	230-241	12
α-helix	247-250	4
α-helix	253-255	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3	A	protein	273	Saccharomyces cerevisiae	P39007 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LGZ_1 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 (chains A)
MGSSHHHHHHSSGLVPRGSHSTWVTRTAYSSPSVVLPSQTPDGKLALIDDFREAYYWLRM
NSDEDSKVAAWWDYGYQIGGMADRTTLVDNNTWNNTHIAIVGKANASPEEKSYEILKEHD
VDYVLVIFGGLIGFGGDDINKFLWNIRISEGIWPEEIKERDFYTAEGEYRVDARASETMR
NSLLYKMSYKDFPQLFNGGQATDRVRQQMITPLDVPPLDYFDEVFTSENWNVRIYQLKKD
DAQGRTLRDVGELTRSSTKTRRSIKRPELGLRV

Primary citation

Eukaryotic N-Glycosylation Occurs via the Membrane-anchored C-terminal Domain of the Stt3p Subunit of Oligosaccharyltransferase. Huang, C., Bhaskaran, R., Mohanty, S. J Biol Chem (2012) 287:32450-32458. DOI 10.1074/jbc.M112.342253 · PubMed

Other PDB entries of the same protein (UniProt P39007 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AGE 2.8 Å, Structure of yeast oligosaccharylransferase complex with acceptor peptide bound
8AGB 3.0 Å, Structure of yeast oligosaccharylransferase complex with lipid-linked oligosaccharide…
8AGC 3.1 Å, Structure of yeast oligosaccharylransferase complex with lipid-linked oligosaccharide…
6EZN 3.3 Å, Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex
7OCI 3.46 Å, Cryo-EM structure of yeast Ost6p containing oligosaccharyltransferase complex
6C26 3.5 Å, The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex

Browse structure collections

About this viewer

MolViewer shows 2LGZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.