2LHH: Ca2+-bound yCaM

Solution structure of Ca2+-bound yCaM. Determined by solution NMR. Released 29 Aug 2012.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,004
Mol. weight: 14.39 kDa
Ligands: CA
Released: 29 Aug 2012

Explore 2LHH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LHH contains 7 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	27	1	1
α-helix	29-39	11
α-helix	45-55	11
β-strand	63	1	1
α-helix	65-73	9
α-helix	85-88	4
α-helix	89-92	4
α-helix	102-111	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin	A	protein	128	Saccharomyces cerevisiae	P06787 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LHH_1 Calmodulin (chains A)
SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGN
HQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAE
LEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3

Primary citation

Solution structures of yeast Saccharomyces cerevisiae calmodulin in calcium- and target peptide-bound states reveal similarities and differences to vertebrate calmodulin. Ogura, K., Kumeta, H., Takahasi, K. et al. Genes Cells (2012) 17:159-172. DOI 10.1111/j.1365-2443.2012.01580.x · PubMed

Other PDB entries of the same protein (UniProt P06787 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6OQQ 2.1 Å, Legionella pneumophila SidJ/Saccharomyces cerevisiae calmodulin complex
1F54 Solution structure of the apo N-terminal domain of yeast calmodulin
1F55 Solution structure of the calcium bound N-terminal domain of yeast calmodulin
1LKJ NMR Structure of Apo Calmodulin from Yeast Saccharomyces cerevisiae
2LHI Solution structure of Ca2+/CNA1 peptide-bound yCaM

Browse structure collections

About this viewer

MolViewer shows 2LHH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.