2LHI: Ca2+/CNA1 peptide-bound yCaM

Solution structure of Ca2+/CNA1 peptide-bound yCaM. Determined by solution NMR. Released 29 Aug 2012.

Method: Solution NMR
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 1
Atoms: 1,352
Mol. weight: 19.4 kDa
Ligands: CA
Released: 29 Aug 2012

Explore 2LHI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LHI contains 11 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3
α-helix	11-17	7
β-strand	27	1	1
α-helix	29-39	11
α-helix	45-52	8
β-strand	63	1	1
α-helix	67-72	6
α-helix	80-92	13
β-strand	100	1	2
α-helix	102-110	9
α-helix	118-129	12
β-strand	135	1	2
α-helix	139-144	6
α-helix	455-458	4
α-helix	460-474	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin,Serine/threonine-protein phosphatase 2B catalytic subunit A1	A	protein	176	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P06787 (AlphaFold model), P23287 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LHI_1 Calmodulin,Serine/threonine-protein phosphatase 2B catalytic subunit A1 (chains A)
GSSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDG
NHQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDA
EVDDMLREVSDGSGEINIQQFAALLSKGSSTGTRRKALRNKILAIAKVSRMFSVLR

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3

Primary citation

Solution structures of yeast Saccharomyces cerevisiae calmodulin in calcium- and target peptide-bound states reveal similarities and differences to vertebrate calmodulin. Ogura, K., Kumeta, H., Takahasi, K. et al. Genes Cells (2012) 17:159-172. DOI 10.1111/j.1365-2443.2012.01580.x · PubMed

Other PDB entries of the same protein (UniProt P06787 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6OQQ 2.1 Å, Legionella pneumophila SidJ/Saccharomyces cerevisiae calmodulin complex
1F54 Solution structure of the apo N-terminal domain of yeast calmodulin
1F55 Solution structure of the calcium bound N-terminal domain of yeast calmodulin
1LKJ NMR Structure of Apo Calmodulin from Yeast Saccharomyces cerevisiae
2LHH Solution structure of Ca2+-bound yCaM

Browse structure collections

About this viewer

MolViewer shows 2LHI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.