2LNL: Human CXCR1 in phospholipid bilayers

Structure of human CXCR1 in phospholipid bilayers. Determined by solid-state NMR. Released 17 Oct 2012.

Method: Solid-state NMR
Organism: Homo sapiens
Chains: 1
Atoms: 2,372
Mol. weight: 35.16 kDa
Released: 17 Oct 2012

Explore 2LNL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LNL contains 16 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	38-66	29
α-helix	75-100	26
α-helix	108	1
α-helix	109-114	6
α-helix	115-138	24
α-helix	149-173	25
α-helix	201-202	2
α-helix	203-212	10
α-helix	213-225	13
α-helix	235-238	4
α-helix	240-267	28
α-helix	276-282	7
α-helix	285-293	9
α-helix	294-298	5
α-helix	300-308	9
α-helix	311-322	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-X-C chemokine receptor type 1	A	protein	309	Homo sapiens	P25024 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LNL_1 C-X-C chemokine receptor type 1 (chains A)
MPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLL
NLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAI
VHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHPNNSSPVCYEVLGNDTAKWR
MVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYN
LVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCLNPIIYAFIGQNFRHGFLKI
LAMHGLVSK

Primary citation

Structure of the chemokine receptor CXCR1 in phospholipid bilayers. Park, S.H., Das, B.B., Casagrande, F. et al. Nature (2012) 491:779-783. DOI 10.1038/nature11580 · PubMed

Other PDB entries of the same protein (UniProt P25024 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8IC0 3.41 Å, Cryo-EM structure of CXCL8 bound C-X-C chemokine receptor 1 in complex with Gi…
1ILP Cxcr-1 N-terminal peptide bound to interleukin-8
1ILQ Cxcr-1 N-terminal peptide bound to interleukin-8 (minimized mean)
6XMN Solution NMR CXCL8-CXCR1 N-domain complex structure

Browse structure collections

About this viewer

MolViewer shows 2LNL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.