Cxcr-1 N-terminal peptide bound to interleukin-8 (minimized mean). Determined by solution NMR. Released 23 Dec 1998.
Explore 1ILQ in 3D Show helices and sheets RCSB PDB PDBe
1ILQ contains 4 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 19-21 | 3 | |
| β-strand | 22-28 | 7 | 1 |
| β-strand | 38-43 | 6 | 1 |
| β-strand | 48-51 | 4 | 1 |
| α-helix | 56-71 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 19-21 | 3 | |
| β-strand | 22-28 | 7 | 1 |
| β-strand | 38-43 | 6 | 1 |
| β-strand | 47-51 | 5 | 1 |
| α-helix | 56-71 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interleukin-8 precursor | A, B | protein | 72 | Homo sapiens | P10145 (AlphaFold model) |
| Interleukin-8 receptor A | C | protein | 19 | Homo sapiens | P25024 (AlphaFold model) |
>1ILQ_1 INTERLEUKIN-8 PRECURSOR (chains A, B) SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQR VVEKFLKRAENS
>1ILQ_2 INTERLEUKIN-8 RECEPTOR A (chains C) XMWDFDDXMPPADEDYSPX
Structure of a CXC chemokine-receptor fragment in complex with interleukin-8. Skelton, N.J., Quan, C., Reilly, D. et al. Structure (1999) 7:157-168. DOI 10.1016/S0969-2126(99)80022-7 · PubMed
Other PDB entries of the same protein (UniProt P10145 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1ILQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.