2LTW: YAP WW1

YAP WW1 in complex with a Smad7 derived peptide. Determined by solution NMR. Released 21 Nov 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 405
Mol. weight: 5.75 kDa
Released: 21 Nov 2012

Explore 2LTW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LTW contains 1 α-helix and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	177-182	6	1
β-strand	186-191	6	1
β-strand	196-198	3	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	205-207	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Yorkie homolog	A	protein	36	Homo sapiens	P46937 (AlphaFold model)
Smad7 derived peptide	B	protein	14	Homo sapiens	O15105 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LTW_1 Yorkie homolog (chains A)
DVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKA

Sequence of entity 2 (B), FASTA

>2LTW_2 Smad7 derived peptide (chains B)
GESPPPPYSRYPMD

Primary citation

Structural Basis for the Versatile Interactions of Smad7 with Regulator WW Domains in TGF-beta Pathways. Aragon, E., Goerner, N., Xi, Q. et al. Structure (2012) 20:1726-1736. DOI 10.1016/j.str.2012.07.014 · PubMed

Other PDB entries of the same protein (UniProt P46937 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6G6X 1.13 Å, 14-3-3sigma in complex with a P129beta3P mutated YAP pS127 phosphopeptide
3MHR 1.15 Å, 14-3-3 sigma in complex with YAP pS127-peptide
7O07 1.2 Å, 14-3-3sigma covalently bound to peptide (chloroacetamide-Cys interaction)
6G8K 1.25 Å, 14-3-3sigma in complex with a S131beta3S mutated YAP pS127 phosphopeptide
6G8L 1.37 Å, 14-3-3sigma in complex with a L132beta3L mutated YAP pS127 phosphopeptide
8A8Q 1.47 Å, Crystal structure of Protein Scalloped in complex with YAP peptide
6G8J 1.47 Å, 14-3-3sigma in complex with a A130beta3A mutated YAP pS127 phosphopeptide
4REX 1.6 Å, Crystal structure of the first WW domain of human YAP2 isoform
6G8I 1.6 Å, 14-3-3sigma in complex with a R124beta3R mutated YAP pS127 phosphopeptide
6GEI 1.65 Å, TEAD4 (216-434);E263A+Y429F complexed with yap peptide (60- 100);S94A and myristoate…
6HIK 1.65 Å, X-ray structure of TEAD4(Y429H) mutant) complexed with YAP (wildtype): Molecular and…
8A8R 1.7 Å, Crystal structure of TEAD4 in complex with YAP peptide

Browse structure collections

About this viewer

MolViewer shows 2LTW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.