2LTX: Smurf1 WW2 domain

Smurf1 WW2 domain in complex with a Smad7 derived peptide. Determined by solution NMR. Released 21 Nov 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 413
Mol. weight: 5.84 kDa
Released: 21 Nov 2012

Explore 2LTX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LTX contains 1 α-helix and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	286-291	6	1
β-strand	295-300	6	1
β-strand	305-307	3	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	207-210	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase SMURF1	A	protein	35	Homo sapiens	Q9HCE7 (AlphaFold model)
Smad7 derived peptide	B	protein	15	Homo sapiens	O15105 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LTX_1 E3 ubiquitin-protein ligase SMURF1 (chains A)
GPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLH

Sequence of entity 2 (B), FASTA

>2LTX_2 Smad7 derived peptide (chains B)
ELESPPPPYSRYPMD

Primary citation

Structural Basis for the Versatile Interactions of Smad7 with Regulator WW Domains in TGF-beta Pathways. Aragon, E., Goerner, N., Xi, Q. et al. Structure (2012) 20:1726-1736. DOI 10.1016/j.str.2012.07.014 · PubMed

Other PDB entries of the same protein (UniProt Q9HCE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PYC 1.96 Å, Crystal structure of human SMURF1 C2 domain
9FSJ 2.05 Å, Crystal structure of the HECT domain of Smurf 1 in complex with inhibitor 8
9FSK 2.75 Å, Crystal structure of the HECT domain of Smurf1
2LAZ Structure of the first WW domain of human Smurf1 in complex with a mono-phosphorylated…
2LB0 Structure of the first WW domain of human Smurf1 in complex with a di-phosphorylated…
2LB1 Structure of the second domain of human Smurf1 in complex with a human Smad1 derived…

Browse structure collections

About this viewer

MolViewer shows 2LTX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.