2M1K: Protein S100-A6

Interaction of Human S100A6 (C3S) with V domain of Receptor for Advanced Glycation End products (RAGE). Determined by solution NMR. Released 25 Mar 2015.

Method: Solution NMR
Organism: Homo sapiens
Chains: 4
Atoms: 2,990
Mol. weight: 42.79 kDa
Released: 25 Mar 2015

Explore 2M1K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M1K contains 12 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	24-28	5	3
β-strand	32-37	6	4
β-strand	48-54	7	3
β-strand	65	1	5
β-strand	68	1	5
α-helix	72-75	4
β-strand	77	1	4
β-strand	83-89	7	4
β-strand	95-102	8	3
β-strand	112-117	6	3

Chains B and D: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-20	17
β-strand	29	1	1
α-helix	31-41	11
α-helix	45-47	3
α-helix	50-60	11
β-strand	68	1	1
α-helix	70-89	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein S100-A6	B, D	protein	90	Homo sapiens	P06703 (AlphaFold model)
Advanced glycosylation end product-specific receptor	A, C	protein	101	Homo sapiens	Q15109 (AlphaFold model)

Sequence of entity 1 (B, D), FASTA

>2M1K_1 Protein S100-A6 (chains B, D)
MASPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDL
DRNKDQEVNFQEYVTFLGALALIYNEALKG

Sequence of entity 2 (A, C), FASTA

>2M1K_2 Advanced glycosylation end product-specific receptor (chains A, C)
AMAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLP
NGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIP

Primary citation

Interaction of the S100A6 mutant (C3S) with the V domain of the receptor for advanced glycation end products (RAGE). Mohan, S.K., Gupta, A.A., Yu, C. Biochem Biophys Res Commun (2013) 434:328-333. DOI 10.1016/j.bbrc.2013.03.049 · PubMed

Other PDB entries of the same protein (UniProt P06703 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1K8U 1.15 Å, Crystal structure of calcium-free (or apo) human S100A6; CYS3MET mutant…
1K96 1.44 Å, Crystal structure of calcium bound human S100A6
1K9K 1.76 Å, Crystal structure of calcium bound human S100A6
1K9P 1.9 Å, Crystal structure of calcium free (or apo) human S100A6
4YBH 2.4 Å, Crystal structure of the human RAGE ectodomain (VC1C2 fragment) in complex with human…

Browse structure collections

About this viewer

MolViewer shows 2M1K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.