2M63: TIR domain-containing adapter molecule 1

The protease-resistant N-terminal domain of TIR-domain containing adaptor molecule-1, TICAM-1. Determined by solution NMR. Released 5 Mar 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,208
Mol. weight: 17.4 kDa
Released: 5 Mar 2014

Explore 2M63 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M63 contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	10-16	7
α-helix	20-30	11
α-helix	40-51	12
α-helix	54-62	9
α-helix	68-76	9
α-helix	94-103	10
α-helix	111-127	17
α-helix	133-143	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TIR domain-containing adapter molecule 1	A	protein	159	Homo sapiens	Q8IUC6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2M63_1 TIR domain-containing adapter molecule 1 (chains A)
GPHMACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEA
RISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVA
YQEAVRTLSSRDDHRLGELQDEARNRCGWDIAGDPGSIR

Primary citation

The N-terminal domain of TIR domain-containing adaptor molecule-1, TICAM-1. Kumeta, H., Sakakibara, H., Enokizono, Y. et al. J Biomol NMR (2014) 58:227-230. DOI 10.1007/s10858-014-9819-1 · PubMed

Other PDB entries of the same protein (UniProt Q8IUC6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RC4 1.5 Å, Molecular mechanisms of viral and host-cell substrate recognition by HCV NS3/4A protease
5JEL 1.6 Å, Phosphorylated TRIF in complex with IRF-3
4BSX 2.23 Å, Crystal Structure of the N terminal domain of TRIF (TIR-domain- containing…
4C0M 2.8 Å, Crystal Structure of the N terminal domain of wild type TRIF (TIR- domain-containing…
9DK8 3.3 Å, TRIF TIR Filament Cryo-EM Structure
8RLM 3.5 Å, TRIF Oligomerisation
2M1X TICAM-1 TIR domain structure

Browse structure collections

About this viewer

MolViewer shows 2M63 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.