Crystal Structure of the N terminal domain of TRIF (TIR-domain- containing adapter-inducing interferon-beta). Determined by X-ray diffraction at 2.23 Å resolution. Released 11 Dec 2013.
Explore 4BSX in 3D Show helices and sheets RCSB PDB PDBe
4BSX contains 40 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-16 | 9 | |
| α-helix | 20-30 | 11 | |
| α-helix | 40-50 | 11 | |
| α-helix | 54-62 | 9 | |
| α-helix | 68-76 | 9 | |
| α-helix | 80-82 | 3 | |
| α-helix | 88-91 | 4 | |
| α-helix | 93-105 | 13 | |
| α-helix | 111-127 | 17 | |
| α-helix | 133-144 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-16 | 9 | |
| α-helix | 20-30 | 11 | |
| α-helix | 40-50 | 11 | |
| α-helix | 54-62 | 9 | |
| α-helix | 68-78 | 11 | |
| α-helix | 80-82 | 3 | |
| α-helix | 88-91 | 4 | |
| α-helix | 93-105 | 13 | |
| α-helix | 111-127 | 17 | |
| α-helix | 133-144 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-16 | 9 | |
| α-helix | 20-30 | 11 | |
| α-helix | 40-50 | 11 | |
| α-helix | 54-63 | 10 | |
| α-helix | 68-77 | 10 | |
| α-helix | 80-82 | 3 | |
| α-helix | 88-91 | 4 | |
| α-helix | 93-105 | 13 | |
| α-helix | 111-127 | 17 | |
| α-helix | 133-144 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-16 | 9 | |
| α-helix | 20-30 | 11 | |
| α-helix | 40-50 | 11 | |
| α-helix | 54-62 | 9 | |
| α-helix | 68-77 | 10 | |
| α-helix | 80-82 | 3 | |
| α-helix | 88-91 | 4 | |
| α-helix | 93-105 | 13 | |
| α-helix | 111-127 | 17 | |
| α-helix | 133-144 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tir domain-containing adapter molecule 1 | A, B, C, D | protein | 156 | HOMO SAPIENS | Q8IUC6 (AlphaFold model) |
>4BSX_1 TIR DOMAIN-CONTAINING ADAPTER MOLECULE 1 (chains A, B, C, D) SNAMACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEA RISLEALKMDAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASMRDVA YQEAVRTLSSRDDHRLGELQDEARNRCGWDIAGDPG
The Tlr Signalling Adaptor Trif/Ticam-1 Has an N-Terminal Helical Domain with Structural Similarity to Ifit Proteins. Ullah, M.O., Ve, T., Mangan, M. et al. Acta Crystallogr D Biol Crystallogr (2013) 69:2420. DOI 10.1107/S0907444913022385 · PubMed
Other PDB entries of the same protein (UniProt Q8IUC6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4BSX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.