The solution structure of the J-domain of human DnaJA1. Determined by solution NMR. Released 26 Jun 2013.
Explore 2M6Y in 3D Show helices and sheets RCSB PDB PDBe
2M6Y contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 17-20 | 4 | |
| α-helix | 29-43 | 15 | |
| α-helix | 52-65 | 14 | |
| α-helix | 68-76 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DnaJ homolog subfamily A member 1 | A | protein | 77 | Homo sapiens | P31689 (AlphaFold model) |
>2M6Y_1 DnaJ homolog subfamily A member 1 (chains A) MGHHHHHHSHMVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQ AYEVLSDAKKRELYDKG
Structure and function of human DnaJ homologue subfamily a member 1 (DNAJA1) and its relationship to pancreatic cancer. Stark, J.L., Mehla, K., Chaika, N. et al. Biochemistry (2014) 53:1360-1372. DOI 10.1021/bi401329a · PubMed
Other PDB entries of the same protein (UniProt P31689 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2M6Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.