2MDF: Two-transmembrane segment TM VI-VII of NHE1

NMR structure of a two-transmembrane segment TM VI-VII of NHE1. Determined by solution NMR. Released 2 Jul 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 442
Mol. weight: 6.26 kDa
Released: 2 Jul 2014

Explore 2MDF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MDF contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	228	1
α-helix	229-233	5
α-helix	239-243	5
α-helix	259-269	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium/hydrogen exchanger 1	A	protein	57	Homo sapiens	P19634 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MDF_1 Sodium/hydrogen exchanger 1 (chains A)
GSKKKDNLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYKKK

Primary citation

Structural and Functional Analysis of the Transmembrane Segment Pair VI and VII of the NHE1 Isoform of the Na(+)/H(+) Exchanger. Alves, C., Lee, B.L., Sykes, B.D. et al. Biochemistry (2014) 53:3658-3670. DOI 10.1021/bi500392y · PubMed

Other PDB entries of the same protein (UniProt P19634 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6NUC 1.9 Å, Structure of Calcineurin in complex with NHE1 peptide
6NUF 1.9 Å, Structure of Calcineurin in complex with NHE1 peptide
9NXE 2.09 Å, Crystal Structure of Calcineurin Clinical Variant E282K
2YGG 2.23 Å, Complex of CaMBR and CaM
6NUU 2.3 Å, Structure of Calcineurin mutant in complex with NHE1 peptide
2BEC 2.7 Å, Crystal structure of CHP2 in complex with its binding region in NHE1 and insights into…
23XI 2.93 Å, Cryo-EM structure of human sodium/proton antiporter NHE1 in complex with Zoniporide in…
23XK 3.1 Å, Cryo-EM structure of human sodium/proton antiporter NHE1 in complex with Cariporide in…
23XO 3.16 Å, Cryo-EM structure of human sodium/proton antiporter NHE1 in complex with Rimeporide in…
23XM 3.24 Å, Cryo-EM structure of human sodium/proton antiporter NHE1 in complex with Eniporide in an…
7DSW 3.3 Å, Structure of a human NHE1-CHP1 complex under pH 7.5
7DSV 3.4 Å, Structure of a human NHE1-CHP1 complex under pH 6.5

Browse structure collections

About this viewer

MolViewer shows 2MDF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.