Structure of the dimerization domain of the human polyoma, JC virus agnoprotein is an amphipathic alpha-helix. Determined by solution NMR. Released 23 Apr 2014.
Explore 2MJ2 in 3D Show helices and sheets RCSB PDB PDBe
2MJ2 contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-23 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Agnoprotein | A | protein | 36 | JC polyomavirus | P03086 (AlphaFold model) |
>2MJ2_1 Agnoprotein (chains A) TWSGTKKRAQRILIFLLEFLLDFCTGEDSVDGKKRQ
The structure of the dimerization domain of the human polyoma, JC virus agnoprotein is an amphipathic alpha-helix. Coric, P., Saribas, S.A., Abou-Gharbia, M. et al. J Virol (2014).
Other PDB entries of the same protein (UniProt P03086 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2MJ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.