Nuclear Magnetic Resonance Structure of the Human Polyoma JC Virus Agnoprotein. Determined by solution NMR. Released 26 Apr 2017.
Explore 5NHQ in 3D Show helices and sheets RCSB PDB PDBe
5NHQ contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-10 | 5 | |
| α-helix | 25-41 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Agnoprotein | A | protein | 71 | JC polyomavirus | P03086 (AlphaFold model) |
>5NHQ_1 Agnoprotein (chains A) MVLRQLSRKASVKVSKTWSGTKKRAQRILIFLLEFLLDFCTGEDSVDGKKRQRHSGLTEQ TYSALPEPKAT
Nuclear Magnetic Resonance Structure of the Human Polyoma JC Virus Agnoprotein. Coric, P., Saribas, A.S., Abou-Gharbia, M. et al. J Cell Biochem (2017) 118:3268-3280. DOI 10.1002/jcb.25977 · PubMed
Other PDB entries of the same protein (UniProt P03086 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5NHQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.