Solution structure of synthetic Mamba-1 peptide. Determined by solution NMR. Released 28 Jan 2015.
Explore 2MJY in 3D Show helices and sheets RCSB PDB PDBe
2MJY contains 0 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-4 | 2 | 1 |
| β-strand | 9-10 | 2 | 1 |
| β-strand | 18-22 | 5 | 2 |
| β-strand | 34-38 | 5 | 2 |
| β-strand | 47 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mambalgin-1 | A | protein | 57 | Dendroaspis polylepis polylepis | P0DKR6 (AlphaFold model) |
>2MJY_1 Mambalgin-1 (chains A) LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK
One-pot hydrazide-based native chemical ligation for efficient chemical synthesis and structure determination of toxin Mambalgin-1. Pan, M., He, Y., Wen, M. et al. Chem Commun (Camb) (2014) 50:5837-5839. DOI 10.1039/c4cc00779d · PubMed
Other PDB entries of the same protein (UniProt P0DKR6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2MJY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.