2MKI: PDB entry 2MKI

Solution structure of tandem RRM domains of cytoplasmic polyadenylation element binding protein 4 (CPEB4) in complex with RNA. Determined by solution NMR. Released 23 Jul 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,708
Mol. weight: 24.33 kDa
Released: 23 Jul 2014

Explore 2MKI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MKI contains 5 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	66-70	5	1
α-helix	72-73	2
α-helix	78-84	7
β-strand	87	1	2
β-strand	89	1	2
β-strand	92-94	3	1
β-strand	111-114	4	1
α-helix	120-126	7
β-strand	129-132	4	1
β-strand	134-137	4	1
β-strand	149-153	5	1
β-strand	160-162	3	3
β-strand	174-178	5	3
α-helix	186-196	11
β-strand	200-208	9	3
β-strand	213-222	10	3
α-helix	225-231	7
β-strand	236	1	3
β-strand	249-252	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytoplasmic polyadenylation element-binding protein 4	A	protein	203	Homo sapiens	Q17RY0 (AlphaFold model)
RNA (5'-r(cpupupup*a)-3')	B	RNA	5

Sequence of entity 1 (A), FASTA

>2MKI_1 Cytoplasmic polyadenylation element-binding protein 4 (chains A)
SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAF
LLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPR
KTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAI
SARFVQLQHGEIDKRVEVKPYVL

Sequence of entity 2 (B), FASTA

>2MKI_2 RNA (5'-R(*CP*UP*UP*UP*A)-3') (chains B)
CUUUA

Primary citation

A fly trap mechanism provides sequence-specific RNA recognition by CPEB proteins. Afroz, T., Skrisovska, L., Belloc, E. et al. Genes Dev (2014) 28:1498-1514. DOI 10.1101/gad.241133.114 · PubMed

Other PDB entries of the same protein (UniProt Q17RY0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5DIF 2.09 Å, Crystal Structure of CPEB4 NES Peptide in complex with CRM1-Ran-RanBP1
2MKJ Solution structure of tandem RRM domains of cytoplasmic polyadenylation element binding…

Browse structure collections

About this viewer

MolViewer shows 2MKI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.